Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0620400_circ_g.1 |
| ID in PlantcircBase | osa_circ_025339 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31533303-31534805 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0620400 |
| Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os04t062040 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0620400_circ_g.2 Os04g0620400_circ_g.3 Os04g0620400_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0620400-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1350641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31533436-31533320(+) |
| Potential amino acid sequence |
MFWHVPGISAASPVDTILDKENFKLEDLLDEDEIIQECKALNTRLINFLRDKVQVEQLLHYIVE EAPEDAEKKRIFRFPFVACEIFTCEVDVIMKTLVENEDLMDLLFSYLKPDRPHGTLLAGYFCKV VICLMLRKTLPFVNYVQLLQGLV*(+) |
| Sponge-miRNAs | osa-miR417 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |