Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0600200_circ_g.7 |
ID in PlantcircBase | osa_circ_002503 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 23575180-23575611 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0600200 |
Parent gene annotation |
Ser/Thr specific protein phosphatase 2A B regulatory subunit bet a isoform. (Os01t0600200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0600200_circ_g.1 Os01g0600200_circ_g.2 Os01g0600200_circ_g.3 Os01g0600200_circ_g.4 Os01g0600200_circ_g.5 Os01g0600200_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0600200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.436296566 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23575196-23575195(+) 23575232-23575447(-) |
Potential amino acid sequence |
MNSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCQSGDGLRVATGSYSNIFRVFGCGTGSNEA TTLEATRNPTSFGILT*(+) MNLECCNWTRVHVNIPKLVGFRVASSVVASLLPVPQPNTRKMLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |