Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0544500_circ_g.6 |
ID in PlantcircBase | osa_circ_037925 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27284286-27285804 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os08g0544500 |
Parent gene annotation |
NCK-associated protein 1 (NAP1)-like protein, Homolog of SCAR/WA VE complex components, Control of epidermal cell morphogenesis ( Os08t0544500-01) |
Parent gene strand | - |
Alternative splicing | Os08g0544500_circ_g.1 Os08g0544500_circ_g.2 Os08g0544500_circ_g.3 Os08g0544500_circ_g.4 Os08g0544500_circ_g.5 Os08g0544500_circ_g.7 Os08g0544500_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0544500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133048415 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27285676-27284331(+) 27285618-27285763(-) |
Potential amino acid sequence |
MYSSLNRESTKFSFRTTCYIFTNQATKFAHSI*(+) MAKSGRTKQKEADLEYNVAKQVEKMLMEVHEQALVSADALHHERRILLKQEIGRMVLFFTDQPS LLAPNIQMVFSALALAQCEVVWYFQHVGIASSKSSRGRTVDIDAADPTIGFLLDGMGKLCCLVR KYIAGCSERKFSTLPVQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |