Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0645400_circ_g.8 |
ID in PlantcircBase | osa_circ_031734 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 26336956-26337694 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0645400 |
Parent gene annotation |
Similar to Isoleucine-tRNA ligase-like protein. (Os06t0645400-01 );Similar to ATP binding protein (Fragment). (Os06t0645400-02) |
Parent gene strand | + |
Alternative splicing | Os06g0645400_circ_g.5 Os06g0645400_circ_g.6 Os06g0645400_circ_g.7 Os06g0645400_circ_g.9 Os06g0645400_circ_g.10 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0645400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.135783593 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26337688-26337620(+) |
Potential amino acid sequence |
MLRIKEDLSVKGALNTLIHFAGARALLLFTGLSQAGL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |