Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0673500_circ_g.2 |
| ID in PlantcircBase | osa_circ_003181 |
| Alias | Os01circ19845/Os_ciR2734 |
| Organism | Oryza sativa |
| Position | chr1: 27661012-27662057 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os01g0673500 |
| Parent gene annotation |
Similar to predicted protein. (Os01t0673500-01);Similar to Katan in p60 ATPase-containing subunit A1 (EC 3.6.4.3) (Katanin p60 su bunit A1) (p60 katanin). Splice isoform 2. (Os01t0673500-02);Sim ilar to predicted protein. (Os01t0673500-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0673500_circ_g.1 Os01g0673500_circ_g.3 Os01g0673500_circ_g.4 Os01g0673500_circ_g.5 |
| Support reads | 2/4/2 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0673500-03:2 Os01t0673500-02:2 Os01t0673500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010546 |
| PMCS | 0.468616108 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27661195-27661054(+) 27662059-27662043(-) 27661016-27662043(-) |
| Potential amino acid sequence |
MACLASCSGKGTRIRFSKRRNIAASSSHGKFVAARTKTRSSVLVNPSIILRHFFLPSFKNRH*( +) MDGLTKTDDLVFVLAATNLPWELDAAMLRRLEKRILVPLPEQEARHAMFEELLPSVPGTMNIPY DVLVEKTEGYSGSDIRLVCKEAAMQPLRRLMSVLEGRQEEVPEDDGWVN*(-) MMDGLTKTDDLVFVLAATNLPWELDAAMLRRLEKRILVPLPEQEARHAMFEELLPSVPGTMNIP YDVLVEKTEGYSGSDIRLVCKEAAMQPLRRLMSVLEGRQEEVPEDDGWVN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |