Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037518_circ_g.2 |
ID in PlantcircBase | zma_circ_009043 |
Alias | zma_circ_0002320 |
Organism | Zea mays |
Position | chr6: 127922415-127924988 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d037518 |
Parent gene annotation |
DCD (Development and Cell Death) domain protein |
Parent gene strand | - |
Alternative splicing | Zm00001d037518_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037518_T009:4 Zm00001d037518_T005:4 Zm00001d037518_T002:4 Zm00001d037518_T007:4 Zm00001d037518_T003:4 Zm00001d037518_T008:4 Zm00001d037518_T004:4 Zm00001d037518_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117098673 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
127924910-127922454(+) 127924858-127924960(-) |
Potential amino acid sequence |
MYSSCWTFLPESLKISLNESISLSDPIGCLQGQLRCGILS*(+) MCNTLATPSIFLIGGYNGVTWLSSLDSFSPEKDAVLGLTPMSSPRSYASAAVLDGHIFAFGGGD GMSWYNTVECYSSRNNEWTECPSMNQKKGSLAGICLNEKIYAIGGGDGNEFYSEVEIFDPYLGK WICSPSMLTSRFALAASGLNGVIYTSGGYDGNMYLKSAERYDPREGFWVRLPSMSTRRGSHTLT VLGDTLLGQTKKYFH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |