Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d037518_circ_g.1 |
| ID in PlantcircBase | zma_circ_009042 |
| Alias | Zm06circ00056 |
| Organism | Zea mays |
| Position | chr6: 127922415-127922684 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d037518 |
| Parent gene annotation |
DCD (Development and Cell Death) domain protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d037518_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d037518_T005:2 Zm00001d037518_T009:2 Zm00001d037518_T002:2 Zm00001d037518_T007:2 Zm00001d037518_T008:2 Zm00001d037518_T004:2 Zm00001d037518_T001:2 Zm00001d037518_T003:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19537 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
127922648-127922454(+) 127922620-127922659(-) |
| Potential amino acid sequence |
MTPFSPDAARANRGCLQGQLRCGILS*(+) MYLKSAERYDPREGFWVRLPSMSTRRGSHTLTVLGDTLGLLLLRPD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |