Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0775400_circ_g.6 |
| ID in PlantcircBase | osa_circ_016734 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32736750-32737083 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0775400 |
| Parent gene annotation |
Similar to Kinesin heavy chain-like protein (Fragment). (Os02t07 75400-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0775400_circ_g.2 Os02g0775400_circ_g.3 Os02g0775400_circ_g.4 Os02g0775400_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0775400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226049626 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32737020-32736765(+) 32737036-32737052(-) |
| Potential amino acid sequence |
MRDRACAGDNTTSSLIPSTNVPSVKIV*(+) MPYPSLLLEKSIDMLDPLTSIYLVAEVIQFSHWEHLLRVSKKK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |