Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0108200_circ_g.5 |
| ID in PlantcircBase | osa_circ_000098 |
| Alias | Os_ciR6517 |
| Organism | Oryza sativa |
| Position | chr1: 446573-446799 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0108200 |
| Parent gene annotation |
Similar to Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cle aving enzyme) (PE). (Os01t0108200-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0108200_circ_igg.1 Os01g0108200_circ_g.1 Os01g0108200_circ_g.2 Os01g0108200_circ_g.3 Os01g0108200_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0108200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.383664207 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
446616-446577(+) 446605-446577(+) 446742-446757(-) |
| Potential amino acid sequence |
MDMLRFHKFTIGHAWTTDYGCSDNEEEFHWLINGLISLGVLLLMLVLWTCSVFTSSPLVMPGLP TMVVQTMKRNSTGLSTA*(+) MLVLWTCSVFTSSPLVMPGLPTMVVQTMKRNSTGLSTA*(+) MTNGELVKTEHVHNTNMSKSTPKEIRPLISQWNSSSLSEQP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |