Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0563000_circ_g.11 |
ID in PlantcircBase | osa_circ_002247 |
Alias | Os01circ14830/Os_ciR690 |
Organism | Oryza sativa |
Position | chr1: 21431623-21433322 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
Parent gene | Os01g0563000 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0563000-01);Peptidyl-prolyl c is-trans isomerase, FKBP-type domain containing protein. (Os01t0 563000-02);Hypothetical conserved gene. (Os01t0563000-03);Hypoth etical conserved gene. (Os01t0563000-04);Hypothetical conserved gene. (Os01t0563000-05);Hypothetical conserved gene. (Os01t05630 00-06) |
Parent gene strand | + |
Alternative splicing | Os01g0563000_circ_igg.1 Os01g0563000_circ_igg.2 Os01g0563000_circ_igg.3 Os01g0563000_circ_igg.4 Os01g0563000_circ_g.1 Os01g0563000_circ_g.2 Os01g0563000_circ_g.3 Os01g0563000_circ_g.4 Os01g0563000_circ_g.5 Os01g0563000_circ_g.6 Os01g0563000_circ_g.7 Os01g0563000_circ_g.8 Os01g0563000_circ_g.9 Os01g0563000_circ_g.10 Os01g0563000_circ_g.12 Os01g0563000_circ_g.13 Os01g0563000_circ_g.14 |
Support reads | 8/44/4 |
Tissues | panicle/root/shoot, root, leaf, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0563000-01:2 Os01t0563000-05:3 Os01t0563000-02:3 Os01t0563000-06:1 Os01t0563000-04:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002143* |
PMCS | 0.492025498 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21431908-21431703(+) |
Potential amino acid sequence |
MPLGQISISLPLCRAMQPSSTRSSSCPSLMYVIMFVLLEKHPLYIPSRDEIVEYASRKEEEGDI YFNLGKHLRAHRRYFKARQIIEYSRFGVRRGKINLIKLLSIPTSEIDAQLEEMWISCTFKAAKC AIQLGCYMQASCYYSECGCSANFKMELFLIVEVTATMNRSSSW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |