Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0563000_circ_g.12 |
| ID in PlantcircBase | osa_circ_002248 |
| Alias | Os_ciR1583 |
| Organism | Oryza sativa |
| Position | chr1: 21431623-21438305 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0563000 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0563000-01);Peptidyl-prolyl c is-trans isomerase, FKBP-type domain containing protein. (Os01t0 563000-02);Hypothetical conserved gene. (Os01t0563000-03);Hypoth etical conserved gene. (Os01t0563000-04);Hypothetical conserved gene. (Os01t0563000-05);Hypothetical conserved gene. (Os01t05630 00-06) |
| Parent gene strand | + |
| Alternative splicing | Os01g0563000_circ_igg.1 Os01g0563000_circ_igg.2 Os01g0563000_circ_igg.3 Os01g0563000_circ_igg.4 Os01g0563000_circ_g.1 Os01g0563000_circ_g.2 Os01g0563000_circ_g.3 Os01g0563000_circ_g.4 Os01g0563000_circ_g.5 Os01g0563000_circ_g.6 Os01g0563000_circ_g.7 Os01g0563000_circ_g.8 Os01g0563000_circ_g.9 Os01g0563000_circ_g.10 Os01g0563000_circ_g.11 Os01g0563000_circ_g.13 Os01g0563000_circ_g.14 |
| Support reads | 9/11 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0563000-06:2 Os01t0563000-02:4 Os01t0563000-01:2 Os01t0563000-04:4 Os01t0563000-05:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.418780877 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21431908-21431703(+) 21438209-21431659(+) |
| Potential amino acid sequence |
MPLGQISISLPLCRAMQPSSTRSSSCPSLMYVIMFVLLEKHPLYIPSRDEIVEYASRKEEEGDI YFNLGKHLRAHRRYFKARQIIEYSRFGVRRGKINLIKLLSIPTSEIDAQLEEMWISCTFKAAKC AIQLGCYMQASCYYSEVLNYDVANVQAQQQQTLLQEFPDGSSRDPDAMQRGFECGCSANFKMEL FLIVEVTATMNRSSSW*(+) MWLMCKPSSSKRCCRNFLMVPQETRTQCSEALSAVARQTSRWNCF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |