Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G332500_circ_g.1 |
| ID in PlantcircBase | gra_circ_001012 |
| Alias | Chr09:34586488|34587715 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 34586488-34587715 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G332500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.009G332500_circ_g.2 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G332500.1:5 Gorai.009G332500.2:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000177 |
| PMCS | 0.10125642 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34586531-34586490(+) |
| Potential amino acid sequence |
MALKEAFKEDEHVENASEGLENGSNSGYHTRSRKEHAVETASTSIEPSNGCPSTDLDGAATDRK NGSKKQKRRRMNDRHVEDAYIKKVDELAKIKQKQDEDKATAKLHALNAISKISEGSIPSSDKIE RMKSLRFTSSSGKC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |