Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G54440_circ_g.5 |
| ID in PlantcircBase | ath_circ_007376 |
| Alias | Ath_circ_FC0781 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20326798-20326956 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI-full, PcircRNA_finder, find_circ, circseq_cup |
| Parent gene | AT1G54440 |
| Parent gene annotation |
Polynucleotidyl transferase, ribonuclease H fold protein with HR DC domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | AT1G54440_circ_g.6 AT1G54440_circ_g.7 |
| Support reads | 10 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G54440.4:1 AT1G54440.5:1 AT1G54440.2:1 AT1G54440.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.632300724 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20326807-20326953(+) |
| Potential amino acid sequence |
MNIEPKIEKTDTGASASSLSLEKVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTD TGASASSLSLEKVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTDTGASASSLSLE KVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTDTGASASSLSLEKVCVDDSKKQS SGFGVLPLKRKLESDKT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |