Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G54440_circ_g.5 |
ID in PlantcircBase | ath_circ_007376 |
Alias | Ath_circ_FC0781 |
Organism | Arabidpsis thaliana |
Position | chr1: 20326798-20326956 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI-full, PcircRNA_finder, find_circ, circseq_cup |
Parent gene | AT1G54440 |
Parent gene annotation |
Polynucleotidyl transferase, ribonuclease H fold protein with HR DC domain-containing protein |
Parent gene strand | + |
Alternative splicing | AT1G54440_circ_g.6 AT1G54440_circ_g.7 |
Support reads | 10 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G54440.4:1 AT1G54440.5:1 AT1G54440.2:1 AT1G54440.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.632300724 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20326807-20326953(+) |
Potential amino acid sequence |
MNIEPKIEKTDTGASASSLSLEKVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTD TGASASSLSLEKVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTDTGASASSLSLE KVCVDDSKKQSSGFGVLPLKRKLESDKTVVEMNIEPKIEKTDTGASASSLSLEKVCVDDSKKQS SGFGVLPLKRKLESDKT(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |