Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0344700_circ_g.9 |
ID in PlantcircBase | osa_circ_019755 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 12842988-12843495 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0344700 |
Parent gene annotation |
Similar to AAA-type ATPase family protein. (Os03t0344700-01) |
Parent gene strand | - |
Alternative splicing | Os03g0344700_circ_igg.1 Os03g0344700_circ_g.2 Os03g0344700_circ_g.3 Os03g0344700_circ_g.4 Os03g0344700_circ_g.5 Os03g0344700_circ_igg.6 Os03g0344700_circ_g.7 Os03g0344700_circ_igg.8 Os03g0344700_circ_g.10 Os03g0344700_circ_g.11 Os03g0344700_circ_g.12 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0344700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.193635072 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12843007-12843065(-) |
Potential amino acid sequence |
MVYFVQVIECGTLVRYSQQVLSLMEKVLQILVHKVKYVFLSKRIDHQRLE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |