Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0108300_circ_g.2 |
ID in PlantcircBase | osa_circ_032585 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 447026-448838 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0108300 |
Parent gene annotation |
Similar to Alanine aminotransferase. (Os07t0108300-01);Similar t o Alanine aminotransferase. (Os07t0108300-02) |
Parent gene strand | - |
Alternative splicing | Os07g0108300_circ_g.1 Os07g0108300_circ_g.3 Os07g0108300_circ_g.4 Os07g0108300_circ_g.5 Os07g0108300_circ_g.6 Os07g0108300_circ_g.7 Os07g0108300_circ_g.8 Os07g0108300_circ_g.9 Os07g0108300_circ_g.10 Os07g0108300_circ_g.11 Os07g0108300_circ_g.12 Os07g0108300_circ_g.13 Os07g0108300_circ_g.14 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0108300-01:5 Os07t0108300-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.251268032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
448826-447086(+) 448783-447094(+) 448828-448813(-) 447136-448830(-) |
Potential amino acid sequence |
MSNRTLLFVRNLTLEQWIFQLLQEA*(+) MERNQLNFPAHRRTHVKQNPSFCPKPDPGTVDIPVASRSLRQ*(+) MGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMG LMVNPPKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPK AIDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGFCLTWVLL*(-) MQPKGLAKRPMFSTASSFLKQLEYPLFQGQVSDKKKGSV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |