Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0108300_circ_g.2 |
| ID in PlantcircBase | osa_circ_032585 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 447026-448838 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0108300 |
| Parent gene annotation |
Similar to Alanine aminotransferase. (Os07t0108300-01);Similar t o Alanine aminotransferase. (Os07t0108300-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0108300_circ_g.1 Os07g0108300_circ_g.3 Os07g0108300_circ_g.4 Os07g0108300_circ_g.5 Os07g0108300_circ_g.6 Os07g0108300_circ_g.7 Os07g0108300_circ_g.8 Os07g0108300_circ_g.9 Os07g0108300_circ_g.10 Os07g0108300_circ_g.11 Os07g0108300_circ_g.12 Os07g0108300_circ_g.13 Os07g0108300_circ_g.14 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0108300-01:5 Os07t0108300-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.251268032 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
448826-447086(+) 448783-447094(+) 448828-448813(-) 447136-448830(-) |
| Potential amino acid sequence |
MSNRTLLFVRNLTLEQWIFQLLQEA*(+) MERNQLNFPAHRRTHVKQNPSFCPKPDPGTVDIPVASRSLRQ*(+) MGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMG LMVNPPKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPK AIDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGFCLTWVLL*(-) MQPKGLAKRPMFSTASSFLKQLEYPLFQGQVSDKKKGSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |