Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0450300_circ_g.4 |
ID in PlantcircBase | osa_circ_039380 |
Alias | Os_ciR1497 |
Organism | Oryza sativa |
Position | chr9: 16857074-16857480 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os09g0450300 |
Parent gene annotation |
MAP65/ASE1 family protein. (Os09t0450300-01);MAP65/ASE1 family p rotein. (Os09t0450300-02);Microtubule-associated protein MAP65-1 a. (Os09t0450300-03) |
Parent gene strand | - |
Alternative splicing | Os09g0450300_circ_g.1 Os09g0450300_circ_g.2 Os09g0450300_circ_g.3 Os09g0450300_circ_g.5 |
Support reads | 9/4 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0450300-01:2 Os09t0450300-03:2 Os09t0450300-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008091* osi_circ_018532 |
PMCS | 0.490469779 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16857460-16857424(+) 16857482-16857454(-) |
Potential amino acid sequence |
MIPLSLSSESIISLVCSGAVLASGSMCADLHISSNSDLFFMKISFNLLALSFVNLSTSAPIFSI VSCERTPGDKISSSDDMRTLSTLLNCLLSS*(+) MRETMESLCKLWKLMDSPQEERRQFNRVLSVLISSEEEILSPGVLSQETIEKMGAEVERLTKLK ARRLKEIFMKKRSELEEICRSAHIEPDASTAPEQTNEMIDSDERDNGIIV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |