Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0450300_circ_g.4 |
| ID in PlantcircBase | osa_circ_039380 |
| Alias | Os_ciR1497 |
| Organism | Oryza sativa |
| Position | chr9: 16857074-16857480 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os09g0450300 |
| Parent gene annotation |
MAP65/ASE1 family protein. (Os09t0450300-01);MAP65/ASE1 family p rotein. (Os09t0450300-02);Microtubule-associated protein MAP65-1 a. (Os09t0450300-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0450300_circ_g.1 Os09g0450300_circ_g.2 Os09g0450300_circ_g.3 Os09g0450300_circ_g.5 |
| Support reads | 9/4 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0450300-01:2 Os09t0450300-03:2 Os09t0450300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008091* osi_circ_018532 |
| PMCS | 0.490469779 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16857460-16857424(+) 16857482-16857454(-) |
| Potential amino acid sequence |
MIPLSLSSESIISLVCSGAVLASGSMCADLHISSNSDLFFMKISFNLLALSFVNLSTSAPIFSI VSCERTPGDKISSSDDMRTLSTLLNCLLSS*(+) MRETMESLCKLWKLMDSPQEERRQFNRVLSVLISSEEEILSPGVLSQETIEKMGAEVERLTKLK ARRLKEIFMKKRSELEEICRSAHIEPDASTAPEQTNEMIDSDERDNGIIV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |