Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0450300_circ_g.1 |
| ID in PlantcircBase | osa_circ_039377 |
| Alias | Os_ciR11829 |
| Organism | Oryza sativa |
| Position | chr9: 16856623-16857480 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0450300 |
| Parent gene annotation |
MAP65/ASE1 family protein. (Os09t0450300-01);MAP65/ASE1 family p rotein. (Os09t0450300-02);Microtubule-associated protein MAP65-1 a. (Os09t0450300-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0450300_circ_g.2 Os09g0450300_circ_g.3 Os09g0450300_circ_g.4 Os09g0450300_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0450300-01:4 Os09t0450300-02:4 Os09t0450300-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214702982 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16857460-16856675(+) 16857482-16857454(-) |
| Potential amino acid sequence |
MIPLSLSSGILVTKIRAFSALLRFM*(+) MRETMESLCKLWKLMDSPQEERRQFNRVLSVLISSEEEILSPGVLSQETIEKMGAEVERLTKLK ARRLKEIFMKKRSELEEICRSAHIEPDASTAPEQTNEMIDSGMIDPSELLAKLESQILKAKEES LSRKDIMDRINKWISACDEEAWLEEYNQDSKRYSAGRGAHINLRRAEKARILVTKIPDERDNGI IV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |