Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0450300_circ_g.1 |
ID in PlantcircBase | osa_circ_039377 |
Alias | Os_ciR11829 |
Organism | Oryza sativa |
Position | chr9: 16856623-16857480 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os09g0450300 |
Parent gene annotation |
MAP65/ASE1 family protein. (Os09t0450300-01);MAP65/ASE1 family p rotein. (Os09t0450300-02);Microtubule-associated protein MAP65-1 a. (Os09t0450300-03) |
Parent gene strand | - |
Alternative splicing | Os09g0450300_circ_g.2 Os09g0450300_circ_g.3 Os09g0450300_circ_g.4 Os09g0450300_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0450300-01:4 Os09t0450300-02:4 Os09t0450300-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.214702982 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16857460-16856675(+) 16857482-16857454(-) |
Potential amino acid sequence |
MIPLSLSSGILVTKIRAFSALLRFM*(+) MRETMESLCKLWKLMDSPQEERRQFNRVLSVLISSEEEILSPGVLSQETIEKMGAEVERLTKLK ARRLKEIFMKKRSELEEICRSAHIEPDASTAPEQTNEMIDSGMIDPSELLAKLESQILKAKEES LSRKDIMDRINKWISACDEEAWLEEYNQDSKRYSAGRGAHINLRRAEKARILVTKIPDERDNGI IV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |