Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0203600_circ_g.5 |
ID in PlantcircBase | osa_circ_036339 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 6036797-6038133 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0203600 |
Parent gene annotation |
Hypothetical conserved gene. (Os08t0203600-01);Hypothetical cons erved gene. (Os08t0203600-02);Hypothetical conserved gene. (Os08 t0203600-03);Similar to SHR5-receptor-like kinase (Fragment). (O s08t0203600-04);Similar to SHR5-receptor-like kinase (Fragment). (Os08t0203600-05);Similar to SHR5-receptor-like kinase (Fragmen t). (Os08t0203600-06) |
Parent gene strand | + |
Alternative splicing | Os08g0203100_circ_ag.1 Os08g0203100_circ_ag.2 Os08g0203100_circ_ag.3 Os08g0203100_circ_ag.4 Os08g0203100_circ_ig.1 Os08g0203300_circ_igg.1 Os08g0203150_circ_ag.1 Os08g0203201_circ_ag.1 Os08g0203201_circ_ig.1 Os08g0203201_circ_ig.2 Os08g0203300_circ_g.1 Os08g0203300_circ_g.2 Os08g0203300_circ_g.3 Os08g0203300_circ_ag.1 Os08g0203300_circ_ag.2 Os08g0203300_circ_g.3 Os08g0203300_circ_g.4 Os08g0203300_circ_ag.5 Os08g0203300_circ_ag.6 Os08g0203300_circ_g.7 Os08g0203400_circ_ag.1 Os08g0203400_circ_ag.2 Os08g0203400_circ_ag.3 Os08g0203400_circ_ag.4 Os08g0203400_circ_ag.5 Os08g0203400_circ_ag.6 Os08g0203400_circ_ag.7 Os08g0203600_circ_g.1 Os08g0203600_circ_g.2 Os08g0203600_circ_g.3 Os08g0203600_circ_g.4 Os08g0203600_circ_ag.1 Os08g0203700_circ_g.1 Os08g0203700_circ_g.2 Os08g0203700_circ_g.3 Os08g0203700_circ_g.4 Os08g0203700_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0203600-05:5 Os08t0203600-04:5 Os08t0203600-02:5 Os08t0203600-03:5 Os08t0203600-06:2 Os08t0203600-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.148321223 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6036834-6036803(+) 6037981-6036798(+) |
Potential amino acid sequence |
MAGGKSFTAVYKSYTATVSKNFLEIHLFWAGKGTCCIPIQGYYGPLISALSITPNFTPTVRNGV PKRKSKVGAIAGISIGASVVGLAALFGIFMFIKKRRRLAQQQGELYNLVGRPDVFSNAELKLAT NNYSSQNILGEGGYGPVYKGMLPDGRVIAVKQLSQSSHQGKNQFVTEVATISSVQHRNLVKLHG CCIDSNTPLLVYEYLENGSLDQALFRKNSLKLDWATRFEIILGIARGLTYLHEESSVRIVHRDI KASNVLLDTDLTPKISDFGLARLYDEKKTHVSTGIAGTLVT*(+) MRSQVCALCIGTSRPAMSYLTPTSPQRYQTLDSLGSMMRRRLMSARGLRAHW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |