Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0203600_circ_g.3 |
| ID in PlantcircBase | osa_circ_036337 |
| Alias | Os_ciR2002 |
| Organism | Oryza sativa |
| Position | chr8: 6034973-6035541 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os08g0203600 |
| Parent gene annotation |
Hypothetical conserved gene. (Os08t0203600-01);Hypothetical cons erved gene. (Os08t0203600-02);Hypothetical conserved gene. (Os08 t0203600-03);Similar to SHR5-receptor-like kinase (Fragment). (O s08t0203600-04);Similar to SHR5-receptor-like kinase (Fragment). (Os08t0203600-05);Similar to SHR5-receptor-like kinase (Fragmen t). (Os08t0203600-06) |
| Parent gene strand | + |
| Alternative splicing | Os08g0203100_circ_ag.1 Os08g0203100_circ_ag.2 Os08g0203100_circ_ag.3 Os08g0203100_circ_ag.4 Os08g0203100_circ_ig.1 Os08g0203300_circ_igg.1 Os08g0203150_circ_ag.1 Os08g0203201_circ_ag.1 Os08g0203201_circ_ig.1 Os08g0203201_circ_ig.2 Os08g0203300_circ_g.1 Os08g0203300_circ_g.2 Os08g0203300_circ_g.3 Os08g0203300_circ_ag.1 Os08g0203300_circ_ag.2 Os08g0203300_circ_g.3 Os08g0203300_circ_g.4 Os08g0203300_circ_ag.5 Os08g0203300_circ_ag.6 Os08g0203300_circ_g.7 Os08g0203400_circ_ag.1 Os08g0203400_circ_ag.2 Os08g0203400_circ_ag.3 Os08g0203400_circ_ag.4 Os08g0203400_circ_ag.5 Os08g0203400_circ_ag.6 Os08g0203400_circ_ag.7 Os08g0203600_circ_g.1 Os08g0203600_circ_g.2 Os08g0203600_circ_g.4 Os08g0203600_circ_g.5 Os08g0203600_circ_ag.1 Os08g0203700_circ_g.1 Os08g0203700_circ_g.2 Os08g0203700_circ_g.3 Os08g0203700_circ_g.4 Os08g0203700_circ_g.5 |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0203600-02:4 Os08t0203600-04:3 Os08t0203600-01:2 Os08t0203600-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018324 |
| PMCS | 0.115699297 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6035371-6035538(+) 6035009-6035376(-) |
| Potential amino acid sequence |
MLTDLFLGNNSLTGGLPDGISPSLKNLRIGDIVSGSSSFAFVSSLTSLNILVLRNCRISGDLGA VDFSKFTKLAFLDLSFNNISGKVPQSILNLQMLTDLFLGNNSLTGGLPDGISPSLKNLRIGDIV SGSSSFAFVSSLTSLNILVLRNCRISGDLGAVDFSKFTKLAFLDLSFNNISGKVPQSILNLQML TDLFLGNNSLTGGLPDGISPSLKNLRIGDIVSGSSSFAFVSSLTSLNILVLRNCRISGDLGAVD FSKFTKLAFLDLSFNNISGKVPQSILNLQMLTDLFLGNNSLTGGLPDGISPSLKN(+) MKSSHLQYLQSVSFLVKGLSHLAVLRLGYCSQETGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |