Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G44910_circ_g.2 |
| ID in PlantcircBase | ath_circ_006044 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 16977707-16978272 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder |
| Parent gene | AT1G44910 |
| Parent gene annotation |
Pre-mRNA-processing protein 40A |
| Parent gene strand | + |
| Alternative splicing | AT1G44910_circ_g.1 AT1G44910_circ_g.3 AT1G44910_circ_g.4 AT1G44910_circ_g.5 AT1G44910_circ_g.6 AT1G44910_circ_g.7 AT1G44910_circ_g.8 AT1G44910_circ_g.9 |
| Support reads | 2 |
| Tissues | leaf, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G44910.1:2 AT1G44910.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.208029338 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16977762-16978269(+) |
| Potential amino acid sequence |
MTPLERADASTVWKEFTTPEGKKYYYNKRTKQSNWEKPLELMTPLERADASTVWKEFTTPEGKK YYYNKRTKQSNWEKPLELMTPLERADASTVWKEFTTPEGKKYYYNKRTKQSNWEKPLELMTPLE RADASTVWKEFTTPEGK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |