Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G44910_circ_g.2 |
ID in PlantcircBase | ath_circ_006044 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 16977707-16978272 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder |
Parent gene | AT1G44910 |
Parent gene annotation |
Pre-mRNA-processing protein 40A |
Parent gene strand | + |
Alternative splicing | AT1G44910_circ_g.1 AT1G44910_circ_g.3 AT1G44910_circ_g.4 AT1G44910_circ_g.5 AT1G44910_circ_g.6 AT1G44910_circ_g.7 AT1G44910_circ_g.8 AT1G44910_circ_g.9 |
Support reads | 2 |
Tissues | leaf, aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G44910.1:2 AT1G44910.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.208029338 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16977762-16978269(+) |
Potential amino acid sequence |
MTPLERADASTVWKEFTTPEGKKYYYNKRTKQSNWEKPLELMTPLERADASTVWKEFTTPEGKK YYYNKRTKQSNWEKPLELMTPLERADASTVWKEFTTPEGKKYYYNKRTKQSNWEKPLELMTPLE RADASTVWKEFTTPEGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |