Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d025323_circ_g.2 |
| ID in PlantcircBase | zma_circ_010304 |
| Alias | zma_circ_0000040 |
| Organism | Zea mays |
| Position | chr10: 114056576-114056938 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d025323 |
| Parent gene annotation |
Probable protein phosphatase 2C 40 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d025323_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d025323_T004:2 Zm00001d025323_T011:2 Zm00001d025323_T008:2 Zm00001d025323_T003:2 Zm00001d025323_T010:2 Zm00001d025323_T012:1 Zm00001d025323_T006:1 Zm00001d025323_T007:2 Zm00001d025323_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.177381241 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
114056783-114056670(+) 114056793-114056794(-) |
| Potential amino acid sequence |
MHPSKFQRDGNRTSRRSACSPPIPEPNPQARSKPGHRGNLRQEKRRRPFLKRPEVRRGCFAYDR STPQLNELHRSGCGRCSHRN*(+) MDASVNAKKKVSFCGNTGHSRCGEVHLAAVCSGRMRSNPFSLQGVSRKGGGAFPDASCPGVLAC CALGGWAQEWGESRRCVDWSCSHLSET*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |