Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d025323_circ_g.2 | 
| ID in PlantcircBase | zma_circ_010304 | 
| Alias | zma_circ_0000040 | 
| Organism | Zea mays | 
| Position | chr10: 114056576-114056938 JBrowse» | 
| Reference genome | AGPv4.38 | 
| Type | u-circRNA | 
| Identification method | find_circ | 
| Parent gene | Zm00001d025323 | 
| Parent gene annotation | 
							Probable protein phosphatase 2C 40 | 
					
| Parent gene strand | - | 
| Alternative splicing | Zm00001d025323_circ_g.1 | 
| Support reads | NA | 
| Tissues | leaf, root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | CT-AC | 
| Number of exons covered | Zm00001d025323_T004:2 Zm00001d025323_T011:2 Zm00001d025323_T008:2 Zm00001d025323_T003:2 Zm00001d025323_T010:2 Zm00001d025323_T012:1 Zm00001d025323_T006:1 Zm00001d025323_T007:2 Zm00001d025323_T001:2  | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA | 
| PMCS | 0.177381241 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							114056783-114056670(+) 114056793-114056794(-)  | 
					
| Potential amino acid sequence | 
							MHPSKFQRDGNRTSRRSACSPPIPEPNPQARSKPGHRGNLRQEKRRRPFLKRPEVRRGCFAYDR STPQLNELHRSGCGRCSHRN*(+) MDASVNAKKKVSFCGNTGHSRCGEVHLAAVCSGRMRSNPFSLQGVSRKGGGAFPDASCPGVLAC CALGGWAQEWGESRRCVDWSCSHLSET*(-)  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Ma et al., 2021b |