Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025323_circ_g.2 |
ID in PlantcircBase | zma_circ_010304 |
Alias | zma_circ_0000040 |
Organism | Zea mays |
Position | chr10: 114056576-114056938 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d025323 |
Parent gene annotation |
Probable protein phosphatase 2C 40 |
Parent gene strand | - |
Alternative splicing | Zm00001d025323_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d025323_T004:2 Zm00001d025323_T011:2 Zm00001d025323_T008:2 Zm00001d025323_T003:2 Zm00001d025323_T010:2 Zm00001d025323_T012:1 Zm00001d025323_T006:1 Zm00001d025323_T007:2 Zm00001d025323_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.177381241 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
114056783-114056670(+) 114056793-114056794(-) |
Potential amino acid sequence |
MHPSKFQRDGNRTSRRSACSPPIPEPNPQARSKPGHRGNLRQEKRRRPFLKRPEVRRGCFAYDR STPQLNELHRSGCGRCSHRN*(+) MDASVNAKKKVSFCGNTGHSRCGEVHLAAVCSGRMRSNPFSLQGVSRKGGGAFPDASCPGVLAC CALGGWAQEWGESRRCVDWSCSHLSET*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |