Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G17320_circ_g.1 |
ID in PlantcircBase | ath_circ_013540 |
Alias | AT2G17320_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 7533688-7534083 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, CIRI-full, CIRI2 |
Parent gene | AT2G17320 |
Parent gene annotation |
AT2G17320 protein |
Parent gene strand | - |
Alternative splicing | AT2G17320_circ_g.2 AT2G17320_circ_g.3 2_circ_ag.4 2_circ_ag.5 2_circ_ag.6 2_circ_ag.7 2_circ_ag.8 AT2G17340_circ_g.1 AT2G17340_circ_g.2 AT2G17340_circ_g.3 AT2G17340_circ_g.4 AT2G17340_circ_g.5 |
Support reads | 1 |
Tissues | whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G17320.2:3 AT2G17320.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.212860756 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7533840-7533690(-) |
Potential amino acid sequence |
MGRGIETNLYAQFKCDSLKIGMLKDGNGQLIGVDTSKLLIANSGNDLAVIDLSRVSHELAYLSS DADLVILEGMGRGIETNLYAQFKCDSLKIGMLKDGNGQLIGVDTSKLLIANSGNDLAVIDLSRV SHELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMLKDGNGQLIGVDTSKLLIANSGND LAVIDLSRVSHELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGM(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |