Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G17340_circ_g.1 |
| ID in PlantcircBase | ath_circ_013548 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 7541821-7542229 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G17340 |
| Parent gene annotation |
Uncharacterized protein At2g17340 |
| Parent gene strand | - |
| Alternative splicing | AT2G17320_circ_g.1 AT2G17320_circ_g.2 AT2G17320_circ_g.3 2_circ_ag.4 2_circ_ag.5 2_circ_ag.6 2_circ_ag.7 2_circ_ag.8 AT2G17340_circ_g.2 AT2G17340_circ_g.3 AT2G17340_circ_g.4 AT2G17340_circ_g.5 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G17340.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.189164467 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7541979-7541823(-) |
| Potential amino acid sequence |
MGRGIETNLYAQFKCDSLKIGMLKDENGQLLGVDTSKLLIANSGNDLPVIDLSRVSQELAYLSS DADLVIVEGMGRGIETNLYAQFKCDSLKIGMLKDENGQLLGVDTSKLLIANSGNDLPVIDLSRV SQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMLKDENGQLLGVDTSKLLIANSGND LPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |