Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0466300_circ_g.1 |
ID in PlantcircBase | osa_circ_007047 |
Alias | Os_ciR6779 |
Organism | Oryza sativa |
Position | chr10: 17204554-17206065 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os10g0466300 |
Parent gene annotation |
Similar to Yarrowia lipolytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os10t0466300-01);Similar to Yarrowia lipol ytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os1 0t0466300-02) |
Parent gene strand | - |
Alternative splicing | Os10g0466300_circ_g.2 Os10g0466300_circ_g.3 Os10g0466300_circ_g.4 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0466300-01:5 Os10t0466300-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.267925838 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17205222-17204595(+) 17204763-17206060(-) 17204582-17206060(-) |
Potential amino acid sequence |
MDCNSFNLGSVIFQCMDAIVISLLASLPNFNSQNLLACLSHKVISS*(+) MSFSENGYFLATAALDGVKLWDLRKLRNFRTISPYDSDTPTNSDC*(-) MTQTRQQILTVKIWQGSEEGNYNCIHTLKDHTAEVEAVTVHATQKYFVTASKDNTWCFYDIPSG SCLTQVGESSGQEGYTSASFHPDGLILGTGTTEAVVKIWDVKTQSNVAKFEGHVGPVTAMSFSE NGYFLATAALDGVKLWDLRKLRNFRTISPYDSDTPTNSDC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |