Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0175500_circ_g.1 |
ID in PlantcircBase | osa_circ_008679 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 3750435-3751506 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0175500 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os11 t0175500-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os11t0175500-02) |
Parent gene strand | + |
Alternative splicing | Os11g0175500_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0175500-02:5 Os11t0175500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009300 osi_circ_017759 |
PMCS | 0.256798134 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3751458-3750482(+) 3751054-3751482(-) |
Potential amino acid sequence |
MRRLHCWSHMPRSRQIFSDAIIVDGRVIQQEAVDIKPGSEIVSGPQKDGHLLYTFDITGLNDQD KTNIKIVLDIENAKCSICLNLWHDVVTVAPCLHNFCNGCFSEWLRRSSANSRDKSQSAACPQCR TAVQSVGRNHFLHNIEEAILQAFSSLQRSDEEIALLESYASVKTNILGCNYCRWKSDPARSS*( +) MLHFAFSISSTILILVLSWSFRPVISKVYNRCPSFWGPETISLPGLMSTASCWITLPSTIIASE NICLDRGI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |