Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0494400_circ_g.2 |
ID in PlantcircBase | osa_circ_037482 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 24410539-24411213 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0494400 |
Parent gene annotation |
Conserved hypothetical protein. (Os08t0494400-01) |
Parent gene strand | + |
Alternative splicing | Os08g0494400_circ_g.1 Os08g0494400_circ_ag.1 Os08g0494400_circ_g.2 Os08g0494400_circ_igg.1 Os08g0494400_circ_ag.2 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0494400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007827* osi_circ_018019 |
PMCS | 0.366950383 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24411052-24410543(+) |
Potential amino acid sequence |
MWYYHLNFTAKTKEDDGFDSTSDNLFFVEVKCMGKGNYEEMVVSCFCVINPIDNGT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |