Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0494400_circ_g.2 |
| ID in PlantcircBase | osa_circ_037482 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 24410539-24411213 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0494400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os08t0494400-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0494400_circ_g.1 Os08g0494400_circ_ag.1 Os08g0494400_circ_g.2 Os08g0494400_circ_igg.1 Os08g0494400_circ_ag.2 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0494400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007827* osi_circ_018019 |
| PMCS | 0.366950383 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24411052-24410543(+) |
| Potential amino acid sequence |
MWYYHLNFTAKTKEDDGFDSTSDNLFFVEVKCMGKGNYEEMVVSCFCVINPIDNGT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |