Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d027265_circ_g.2 |
ID in PlantcircBase | zma_circ_006335 |
Alias | zma_circ_0000215 |
Organism | Zea mays |
Position | chr1: 1016683-1021126 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d027265 |
Parent gene annotation |
ATPase 7 plasma membrane-type |
Parent gene strand | + |
Alternative splicing | Zm00001d027265_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d027265_T007:2 Zm00001d027265_T005:2 Zm00001d027265_T004:2 Zm00001d027265_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.085906106 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1016819-1016690(+) 1021104-1016690(+) 1016768-1020985(-) |
Potential amino acid sequence |
MITGDQLAIAKETGRRLGMGTNMYPSSSLLGDKKGDIAVLPVDELIEQADGFAGVFPGST*(+) MDLLEFSQEVPEGTKESSGGPWQFIGLLPLFDPPRHDSAETIRRALDLGVSVKMITGDQLAIAK ETGRRLGMGTNMYPSSSLLGDKKGDIAVLPVDELIEQADGFAGVFPGST*(+) MARRIKEWEKTNKLPRPTRTFLSPFRYFLGKLQQIHPLAQSIRPLVELRCHLFCHPAMMKKDTC LCPFLVSGQSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |