Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0382300_circ_g.1 |
ID in PlantcircBase | osa_circ_023588 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 18748289-18749605 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0382300 |
Parent gene annotation |
Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-01);Similar to SNF1-rela ted protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKI NG1). (Os04t0382300-02);Similar to OSIGBa0092E09.6 protein. (Os0 4t0382300-03) |
Parent gene strand | - |
Alternative splicing | Os04g0382300_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0382300-02:3 Os04t0382300-01:3 Os04t0382300-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014290 |
PMCS | 0.190653986 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18749474-18748290(+) |
Potential amino acid sequence |
MPMYLSIQLASSGASTFLMGALKILFLDNISTVSARLAFEGISIT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |