Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0382300_circ_g.1 |
| ID in PlantcircBase | osa_circ_023588 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 18748289-18749605 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0382300 |
| Parent gene annotation |
Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-01);Similar to SNF1-rela ted protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKI NG1). (Os04t0382300-02);Similar to OSIGBa0092E09.6 protein. (Os0 4t0382300-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0382300_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0382300-02:3 Os04t0382300-01:3 Os04t0382300-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014290 |
| PMCS | 0.190653986 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18749474-18748290(+) |
| Potential amino acid sequence |
MPMYLSIQLASSGASTFLMGALKILFLDNISTVSARLAFEGISIT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |