Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0152800_circ_g.4 |
ID in PlantcircBase | osa_circ_013180 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 2916419-2917951 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0152800 |
Parent gene annotation |
RNA polymerase Rpb1, domain 1 containing protein. (Os02t0152800- 01) |
Parent gene strand | - |
Alternative splicing | Os02g0152800_circ_igg.1 Os02g0152800_circ_g.1 Os02g0152800_circ_g.2 Os02g0152800_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0152800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.129975707 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2917896-2916433(+) 2916436-2916905(-) 2917949-2917915(-) |
Potential amino acid sequence |
MLLMAPSATGIADWSSSIYPTIVA*(+) MLLLSDRWRRTSQQFRLLKVPSRASSLAYPLRMRFVLIL*(-) MEEDQSAIPVAEGAIKSIKLSLSTEDEIRTYSINDCPVTHPSQLGNPFLGLPLETGKCESCGAS ENGKCEGHFGYIELPVPIYHPCHVTELRQILNVVCLKCLRVKKGKVKQTEGKDNTSALSCYYCR IDGGGPVSNSGC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |