Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0786000_circ_g.4 |
| ID in PlantcircBase | osa_circ_016845 |
| Alias | Os02circ28357/Os_ciR2071 |
| Organism | Oryza sativa |
| Position | chr2: 33375442-33375581 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl, find_circ |
| Parent gene | Os02g0786000 |
| Parent gene annotation |
Similar to predicted protein. (Os02t0786000-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0786000_circ_g.3 |
| Support reads | 2/9 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0786000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.415349345 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33375470-33375469(+) 33375522-33375509(+) 33375508-33375547(-) |
| Potential amino acid sequence |
MSPKSPPVSMRFIPEPTDEGKPKHDTNGSSDLSQQPSSFQQSENFQS*(+) MKESRNMILMDLLTCPNNLQAFNSPRTFNHESKESTCFDALHS*(+) MKRIETGGLFGLMIESSRTVESLKVVGTSQKIH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015 |