Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0103000_circ_g.7 |
| ID in PlantcircBase | osa_circ_035538 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 174271-175675 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0103000 |
| Parent gene annotation |
Similar to serine/threonine-protein kinase CTR1. (Os08t0103000-0 1);Similar to serine/threonine-protein kinase CTR1. (Os08t010300 0-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0103000_circ_g.2 Os08g0103000_circ_g.3 Os08g0103000_circ_g.4 Os08g0103000_circ_g.5 Os08g0103000_circ_g.6 Os08g0103000_circ_g.8 Os08g0103000_circ_g.9 Os08g0103000_circ_g.10 Os08g0103000_circ_g.11 Os08g0103000_circ_g.12 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0103000-02:2 Os08t0103000-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007483* |
| PMCS | 0.232719015 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
175619-174862(+) 175021-175651(-) |
| Potential amino acid sequence |
MRISENLYSNIKTIVSSSIPRVPSIYRFQFQQSFVPLDFLVEPHQSLRSSQLDDSP*(+) MPGGNLYDFLHKQNNVLDLLTILRIAISISKGMNYLHQNNIIHRDLKTANLLMGYHQVVKIADF GVARQGNQEGQMTAETGTYRWMAPEVSRNLQWS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |