Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0103000_circ_g.4 |
| ID in PlantcircBase | osa_circ_035535 |
| Alias | Os_ciR11402 |
| Organism | Oryza sativa |
| Position | chr8: 173177-174366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0103000 |
| Parent gene annotation |
Similar to serine/threonine-protein kinase CTR1. (Os08t0103000-0 1);Similar to serine/threonine-protein kinase CTR1. (Os08t010300 0-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0103000_circ_g.2 Os08g0103000_circ_g.3 Os08g0103000_circ_g.5 Os08g0103000_circ_g.6 Os08g0103000_circ_g.7 Os08g0103000_circ_g.8 Os08g0103000_circ_g.9 Os08g0103000_circ_g.10 Os08g0103000_circ_g.11 Os08g0103000_circ_g.12 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0103000-02:3 Os08t0103000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.13503612 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
173402-173188(+) 174314-173179(-) |
| Potential amino acid sequence |
MVNDLGCHPSIGSSFSSHLSLLISLSSHTKVCDLHNLPYS*(+) MTAETGTYRWMAPEIINHKPYDNKADVFSFAIVLWELVTLKVPYDNMTPLQAALGVRQVVKIAD FGVARQGNQEGQMTAETGTYRWMAPEIINHKPYDNKADVFSFAIVLWELVTLKVPYDNMTPLQA ALGVRQVVKIADFGVARQGNQEGQMTAETGTYRWMAPEIINHKPYDNKADVFSFAIVLWELVTL KVPYDNMTPLQAALGVRQVVKIADFGVARQGNQEGQMTAETGTYRWMAPEIINHKPYDNKADVF SFAIVLWELVTLKVPYDNMTPLQAALGVRQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |