Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G21105_circ_g.5 |
ID in PlantcircBase | ath_circ_039631 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 7173737-7173949 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT5G21105 |
Parent gene annotation |
Plant L-ascorbate oxidase |
Parent gene strand | + |
Alternative splicing | 5_circ_ag.2 AT5G21105_circ_g.1 AT5G21105_circ_g.2 AT5G21105_circ_g.3 AT5G21105_circ_g.4 AT5G21105_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G21105.2:1 AT5G21105.1:1 AT5G21105.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.397668323 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7173770-7173946(+) |
Potential amino acid sequence |
MQRSAGLYGSLIVDVAKGKSERLRYDGEFNLLLSDWWHEAIPSQELGLSSKPMRWIGEAQPGTH FYHGHYGMQRSAGLYGSLIVDVAKGKSERLRYDGEFNLLLSDWWHEAIPSQELGLSSKPMRWIG EAQPGTHFYHGHYGMQRSAGLYGSLIVDVAKGKSERLRYDGEFNLLLSDWWHEAIPSQELGLSS KPMRWIGEAQPGTHFYHGHYGMQRSAGLYGSLIVDVAKGKSERLRYDGEFNLLLSDWWHEAIPS QELGLSSKPMRWIGEAQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |