Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d028238_circ_g.4 |
ID in PlantcircBase | zma_circ_006439 |
Alias | Zm01circ00040 |
Organism | Zea mays |
Position | chr1: 27589725-27594171 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d028238 |
Parent gene annotation |
CCAAT-binding factor |
Parent gene strand | - |
Alternative splicing | Zm00001d028238_circ_g.1 Zm00001d028238_circ_g.2 Zm00001d028238_circ_g.3 Zm00001d028238_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d028238_T003:7 Zm00001d028238_T012:7 Zm00001d028238_T008:8 Zm00001d028238_T002:7 Zm00001d028238_T005:7 Zm00001d028238_T007:7 Zm00001d028238_T001:7 Zm00001d028238_T006:7 Zm00001d028238_T004:7 Zm00001d028238_T011:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.024099279 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27592180-27594162(-) |
Potential amino acid sequence |
MLLKSKSEQERRLLTALVNKLGDPERRAASSAAYLLTCLLAAHPNMKMVVIDEVDSFLFRPHVG LRAKYQAVNFLSQILLTNKGDGPKIAKRLVDVYIALFKVLMSSGDTKGDTYSKDSKKKVGKIEG GNNKMDSRSKGNNEVGSTAGSDLELDSRILSALLTGVNRALPYVASSEVDDIVEVQTPILFRLV HAENFNVGVQALMLLFQISIKNNIASDRLYRALYSKLLSPSAVTSSKYDR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |