Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0832400_circ_g.7 |
| ID in PlantcircBase | osa_circ_017387 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35792509-35793579 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0832400 |
| Parent gene annotation |
Similar to Callose synthase 1 catalytic subunit. (Os02t0832400-0 1);Similar to Callose synthase 1 catalytic subunit. (Os02t083240 0-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0832400_circ_g.1 Os02g0832400_circ_g.2 Os02g0832400_circ_g.3 Os02g0832400_circ_g.4 Os02g0832400_circ_g.5 Os02g0832400_circ_g.6 |
| Support reads | 7 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0832400-01:5 Os02t0832400-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.280124261 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35792510-35792516(+) |
| Potential amino acid sequence |
MAFELYGMLAGNVSPTTGENVKPAYGGDEEAFLKKVVTPIYKVIEKEAERSESSERSERSKTTK SKHSHWRNYDDLNEYFWSRDCFRLGWPMRADADFFKTPDYAYHDEVSGENRRVGSGQWMGKVNF VEIRSFWHIFRSFDRMWSFLILSLQAMIIIAWNGGTPSDIFDAGVFKQVLSIFITAAILKLGQD GF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |