Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0526700_circ_g.4 |
ID in PlantcircBase | osa_circ_037783 |
Alias | Os_ciR11577 |
Organism | Oryza sativa |
Position | chr8: 26216368-26217540 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os08g0526700 |
Parent gene annotation |
Similar to UBA/UBX 33.3 kDa protein. (Os08t0526700-00) |
Parent gene strand | + |
Alternative splicing | Os08g0526700_circ_g.2 Os08g0526700_circ_g.3 Os08g0526700_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0526700-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.114936466 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26217464-26217407(+) 26216376-26217436(-) |
Potential amino acid sequence |
MESRKADQEEEKRTRERIRKRIEDDKETSQVERELNADQNEDEVRRRIIELFKSKQDGQERERG RIRNQLQEDKRERIRAAKDLMEAKRTLEENQRKRFVSYATCM*(+) MFPYHLQYASGFSLLFFSPPLDLLFDSPSHCTKKTVS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |