Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0526700_circ_g.4 |
| ID in PlantcircBase | osa_circ_037783 |
| Alias | Os_ciR11577 |
| Organism | Oryza sativa |
| Position | chr8: 26216368-26217540 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0526700 |
| Parent gene annotation |
Similar to UBA/UBX 33.3 kDa protein. (Os08t0526700-00) |
| Parent gene strand | + |
| Alternative splicing | Os08g0526700_circ_g.2 Os08g0526700_circ_g.3 Os08g0526700_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0526700-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114936466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26217464-26217407(+) 26216376-26217436(-) |
| Potential amino acid sequence |
MESRKADQEEEKRTRERIRKRIEDDKETSQVERELNADQNEDEVRRRIIELFKSKQDGQERERG RIRNQLQEDKRERIRAAKDLMEAKRTLEENQRKRFVSYATCM*(+) MFPYHLQYASGFSLLFFSPPLDLLFDSPSHCTKKTVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |