Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0562700_circ_g.18 |
ID in PlantcircBase | osa_circ_038127 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 28179378-28180009 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0562700 |
Parent gene annotation |
Similar to peptidase M1 family protein. (Os08t0562700-01);Simila r to predicted protein. (Os08t0562700-02) |
Parent gene strand | - |
Alternative splicing | Os08g0562700_circ_g.17 Os08g0562700_circ_g.19 Os08g0562700_circ_g.20 Os08g0562700_circ_g.21 Os08g0562700_circ_g.22 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0562700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.11881635 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28179481-28179973(-) |
Potential amino acid sequence |
MVDSRHLTVSRPPGGTFNLEIVTEIYPQLNTSLEVPPLHLLFMGVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |