Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0562700_circ_g.18 |
| ID in PlantcircBase | osa_circ_038127 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 28179378-28180009 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0562700 |
| Parent gene annotation |
Similar to peptidase M1 family protein. (Os08t0562700-01);Simila r to predicted protein. (Os08t0562700-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0562700_circ_g.17 Os08g0562700_circ_g.19 Os08g0562700_circ_g.20 Os08g0562700_circ_g.21 Os08g0562700_circ_g.22 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0562700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11881635 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28179481-28179973(-) |
| Potential amino acid sequence |
MVDSRHLTVSRPPGGTFNLEIVTEIYPQLNTSLEVPPLHLLFMGVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |