Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0154500_circ_g.1 |
| ID in PlantcircBase | osa_circ_029731 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 2807790-2809831 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0154500 |
| Parent gene annotation |
Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height (Os0 6t0154500-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0154500_circ_g.2 Os06g0154500_circ_g.3 Os06g0154500_circ_g.4 Os06g0154500_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0154500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.206140169 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2809810-2807844(+) 2809758-2809781(-) |
| Potential amino acid sequence |
MISLMATICYSLSRIKCQHLFNQINC*(+) MDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGL ARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLR LLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRIT DCCHKGYHTSSTKEFIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |