Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0154500_circ_g.1 |
ID in PlantcircBase | osa_circ_029731 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 2807790-2809831 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0154500 |
Parent gene annotation |
Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height (Os0 6t0154500-01) |
Parent gene strand | - |
Alternative splicing | Os06g0154500_circ_g.2 Os06g0154500_circ_g.3 Os06g0154500_circ_g.4 Os06g0154500_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0154500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.206140169 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2809810-2807844(+) 2809758-2809781(-) |
Potential amino acid sequence |
MISLMATICYSLSRIKCQHLFNQINC*(+) MDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGL ARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLR LLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRIT DCCHKGYHTSSTKEFIQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |