Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0462900_circ_g.18 |
| ID in PlantcircBase | osa_circ_007037 |
| Alias | Os_ciR6775 |
| Organism | Oryza sativa |
| Position | chr10: 17052147-17052839 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0462900 |
| Parent gene annotation |
Similar to mitochondrial chaperonin-60. (Os10t0462900-01);Simila r to mitochondrial chaperonin-60. (Os10t0462900-02) |
| Parent gene strand | + |
| Alternative splicing | Os10g0462900_circ_g.1 Os10g0462900_circ_g.2 Os10g0462900_circ_g.3 Os10g0462900_circ_g.4 Os10g0462900_circ_g.5 Os10g0462900_circ_g.6 Os10g0462900_circ_g.7 Os10g0462900_circ_g.8 Os10g0462900_circ_g.9 Os10g0462900_circ_g.10 Os10g0462900_circ_g.11 Os10g0462900_circ_g.12 Os10g0462900_circ_g.13 Os10g0462900_circ_g.14 Os10g0462900_circ_g.15 Os10g0462900_circ_g.16 Os10g0462900_circ_g.17 Os10g0462900_circ_g.19 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0462900-02:4 Os10t0462900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008487 |
| PMCS | 0.203959091 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17052776-17052192(+) 17052206-17052804(-) |
| Potential amino acid sequence |
MVKAGIIDPLKVIRTALVDAARSEEPVKLKLVRRRIE*(+) MHLSLYPSSHQLQLHWLLRSCSIHQGSSDHF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |