Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G074100_circ_g.1 |
| ID in PlantcircBase | gra_circ_000249 |
| Alias | Chr03:17723251|17723583 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 17723251-17723583 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G074100 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G074100.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000439 ghi_circ_000026* |
| PMCS | 0.502502127 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17723562-17723515(-) 17723404-17723251(+) |
| Potential amino acid sequence |
MLYSYKHGFSGFAARLTDSQAREIEAFPGVVQVIPNQVHKFHTTRSWDFMGLNDHSTKNLLTKS NMGEGIIIGVIDSARKQQKVQCFIAINMAFPGLQPG*(-) MLQFPLPGNLSTWLQTRKSHVYSYKALNFLLLPC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |