Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0279000_circ_g.3 |
| ID in PlantcircBase | osa_circ_038689 |
| Alias | Os_ciR1941 |
| Organism | Oryza sativa |
| Position | chr9: 5841477-5841720 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup, find_circ |
| Parent gene | Os09g0279000 |
| Parent gene annotation |
Similar to r-interacting factor1. (Os09t0279000-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0279000_circ_g.2 |
| Support reads | 5/3/3 |
| Tissues | root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0279000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.704016887 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5841691-5841678(-) |
| Potential amino acid sequence |
MLPNNAQPMHDLAPSPTTSGRKRQKTSQSFPALPAPPPVMHSQQLALQGPPSSSTAKKGASSGA KGKKTKPGMEISRRASSNVTQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |