Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0279000_circ_g.3 |
ID in PlantcircBase | osa_circ_038689 |
Alias | Os_ciR1941 |
Organism | Oryza sativa |
Position | chr9: 5841477-5841720 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup, find_circ |
Parent gene | Os09g0279000 |
Parent gene annotation |
Similar to r-interacting factor1. (Os09t0279000-01) |
Parent gene strand | - |
Alternative splicing | Os09g0279000_circ_g.2 |
Support reads | 5/3/3 |
Tissues | root/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0279000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.704016887 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5841691-5841678(-) |
Potential amino acid sequence |
MLPNNAQPMHDLAPSPTTSGRKRQKTSQSFPALPAPPPVMHSQQLALQGPPSSSTAKKGASSGA KGKKTKPGMEISRRASSNVTQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |