Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0279000_circ_g.2 |
ID in PlantcircBase | osa_circ_038688 |
Alias | Os_ciR11999 |
Organism | Oryza sativa |
Position | chr9: 5841032-5842204 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os09g0279000 |
Parent gene annotation |
Similar to r-interacting factor1. (Os09t0279000-01) |
Parent gene strand | - |
Alternative splicing | Os09g0279000_circ_g.3 |
Support reads | 2/11 |
Tissues | root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0279000-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007987* osi_circ_018859 |
PMCS | 0.307930527 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5842084-5841888(-) |
Potential amino acid sequence |
MATQIHHLEQEAYCSVLRAFKAQSDAITWEKEGLITELRKELRVSDVDHRELLNRVNSDDIIRS IREWRSAGGPQAMLPNNAQPMHDLAPSPTTSGRKRQKTSQSFPALPAPPPVMHSQQLALQGPPS SSTAKKGASSGAKGKKTKPGQKVPGGPSVKAMTSSAGPSGRGPHMNRNFPVGLVSFEPSEALHI NPLINRKVMSRWPEDNSFYEATITDYNPETDLYALAYDINTANESWEWVDLKQELLMIFLHHIQ AIGVLEAVDVSVVMEELLFLLVHTLEPILIWQHKSIILNKKHIARFFVHLKPSLTPLHGRKKVS *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |