Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0209300_circ_g.4 |
ID in PlantcircBase | osa_circ_030158 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 5577611-5577667 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os06g0209300 |
Parent gene annotation |
Hypothetical conserved gene. (Os06t0209300-01);Conserved hypothe tical protein. (Os06t0209300-02);Hypothetical conserved gene. (O s06t0209300-03) |
Parent gene strand | - |
Alternative splicing | Os06g0209300_circ_g.2 Os06g0209300_circ_g.3 Os06g0209300_circ_g.5 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0209300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.141812865 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5577627-5577613(-) |
Potential amino acid sequence |
MKQMRADLLQLHGPEEVKNMKQMRADLLQLHGPEEVKNMKQMRADLLQLHGPEEVKNMKQMR(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |