Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0596000_circ_g.1 |
ID in PlantcircBase | osa_circ_034622 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 24254366-24255176 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0596000 |
Parent gene annotation |
Zinc finger, DHHC-type domain containing protein. (Os07t0596000- 01) |
Parent gene strand | - |
Alternative splicing | Os07g0596000_circ_g.2 Os07g0596000_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0596000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.364702795 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24255078-24254439(+) 24254472-24255113(-) |
Potential amino acid sequence |
MENSFRSTKQNTSTNTPTADCRISWPKVHKSCRPDLQEIILEEYTMNHDVVHQRNLYC*(+) MSRVSSYTGLSSTSSFGGRRRGSWCTPPRLFLEDQVYMICALWASLSYNQQLEYWC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |