Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G21160_circ_g.1 |
ID in PlantcircBase | ath_circ_014137 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 9068944-9069111 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G21160 |
Parent gene annotation |
Translocon-associated protein subunit alpha |
Parent gene strand | + |
Alternative splicing | AT2G21160_circ_g.2 AT2G21160_circ_g.3 AT2G21160_circ_g.4 AT2G21160_circ_g.5 AT2G21160_circ_g.6 AT2G21160_circ_g.7 AT2G21160_circ_g.8 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G21160.2:1 AT2G21160.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230156345 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9069048-9069108(+) |
Potential amino acid sequence |
MNLSSFPGVETVCVFPKNSAKFARCQSDAEDHSSLVDDVVGENTDDAVEEDDHDLDMNLSSFPG VETVCVFPKNSAKFARCQSDAEDHSSLVDDVVGENTDDAVEEDDHDLDMNLSSFPGVETVCVFP KNSAKFARCQSDAEDHSSLVDDVVGENTDDAVEEDDHDLDMNLSSFPGVETVCVFPKNSAK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |