Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0202250_circ_g.4 |
ID in PlantcircBase | osa_circ_013716 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 5713889-5716572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0202250 |
Parent gene annotation |
Hypothetical conserved gene. (Os02t0202250-01) |
Parent gene strand | - |
Alternative splicing | Os02g0202250_circ_g.2 Os02g0202250_circ_g.3 Os02g0202250_circ_g.5 Os02g0202250_circ_g.6 Os02g0202250_circ_g.7 Os02g0202250_circ_g.8 Os02g0202250_circ_g.9 Os02g0202250_circ_g.10 Os02g0202250_circ_igg.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0202250-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215307855 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5713914-5713891(-) |
Potential amino acid sequence |
MVVSILGKANSRLNSNVVKERAGEIDKRRSLTAPILRIVTSFTSLVDSADFLEVKNKIVRELVD FAKQHQPVFNIILRESISGANIFNLERLNMVVSILGKANSRLNSNVVKERAGEIDKRRSLTAPI LRIVTSFTSLVDSADFLEVKNKIVRELVDFAKQHQPVFNIILRESISGANIFNLERLNMVVSIL GKANSRLNSNVVKERAGEIDKRRSLTAPILRIVTSFTSLVDSADFLEVKNKIVRELVDFAKQHQ PVFNIILRESISGANIFNLERLNMVVSILGK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |