Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0153700_circ_g.4 |
ID in PlantcircBase | osa_circ_008497 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 2520207-2520800 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0153700 |
Parent gene annotation |
Similar to Signal recognition particle 54 kDa protein, chloropla st precursor (SRP54) (54 chloroplast protein) (54CP) (FFC). (Os1 1t0153700-01) |
Parent gene strand | + |
Alternative splicing | Os11g0153700_circ_g.1 Os11g0153700_circ_g.2 Os11g0153700_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0153700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009248 |
PMCS | 0.281087233 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2520250-2520259(+) 2520252-2520542(-) |
Potential amino acid sequence |
MEDLEPFYPDRMAQRILGMGDVLSFVEKAQEVMRQEDAEELQKKILSAKFNFNDFLKQTQAIAQ MGSFSRIIGMIPGMNKVTPAQIREAEKNLKFMESMINVMTPGIWKAHQVCRARRTHGRS*(+) MRSPRPTNLMGFPDTRGHYVDHGLHKFKVFLRFTNLSRGNLVHAWNHANYTTK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |