Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0153700_circ_g.4 |
| ID in PlantcircBase | osa_circ_008497 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 2520207-2520800 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0153700 |
| Parent gene annotation |
Similar to Signal recognition particle 54 kDa protein, chloropla st precursor (SRP54) (54 chloroplast protein) (54CP) (FFC). (Os1 1t0153700-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0153700_circ_g.1 Os11g0153700_circ_g.2 Os11g0153700_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0153700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009248 |
| PMCS | 0.281087233 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2520250-2520259(+) 2520252-2520542(-) |
| Potential amino acid sequence |
MEDLEPFYPDRMAQRILGMGDVLSFVEKAQEVMRQEDAEELQKKILSAKFNFNDFLKQTQAIAQ MGSFSRIIGMIPGMNKVTPAQIREAEKNLKFMESMINVMTPGIWKAHQVCRARRTHGRS*(+) MRSPRPTNLMGFPDTRGHYVDHGLHKFKVFLRFTNLSRGNLVHAWNHANYTTK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |