Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0205000_circ_g.1 |
ID in PlantcircBase | osa_circ_018420 |
Alias | Os_ciR9090 |
Organism | Oryza sativa |
Position | chr3: 5485943-5486703 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0205000 |
Parent gene annotation |
Ubiquitin system component Cue domain containing protein. (Os03t 0205000-01) |
Parent gene strand | - |
Alternative splicing | Os03g0205000_circ_g.2 Os03g0205000_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0205000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.515712823 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5486290-5486680(-) |
Potential amino acid sequence |
MSSSQSNGETASDIILSDIVLGIRMLSRRTVSFGWRLLEFCYLNNQLVERDVEACTKMFPAKVE DPMIRGDIIIQTLKDINREATFSQDHPGKTFLQALEKEFKLMNRIGDIRKKGAHFIWTE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |