Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0409900_circ_g.3 |
| ID in PlantcircBase | osa_circ_033484 |
| Alias | Os07circ06380/Os_ciR898 |
| Organism | Oryza sativa |
| Position | chr7: 12797686-12801684 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os07g0409900 |
| Parent gene annotation |
Plasma membrane-associated calcium-dependent protein kinase, Dir ect phosphorylation and activation of MAPK, Negative reguration of rice immunity (Os07t0409900-01);Similar to Calcium-dependent protein kinase. (Os07t0409900-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0409900_circ_g.1 Os07g0409900_circ_g.2 Os07g0409900_circ_g.4 Os07g0409900_circ_g.5 Os07g0409900_circ_g.6 Os07g0409900_circ_g.7 |
| Support reads | 6/21/5 |
| Tissues | leaf and panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0409900-01:7 Os07t0409900-02:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016974 |
| PMCS | 0.447309531 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12801201-12801678(-) |
| Potential amino acid sequence |
MLKVAAECHLHGLVHRDMKPENFLFKSTKEDSSLKATDFGLSDFIRPGKHFRDIVGSAYYVAPE VLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPWPNITPCAKDFV QKLLVKDPRARLTAAQALSHEWVREGGQASDIPLDISVLHNMRQFVKYSRFKQFALRALASTLN AEELSDLRDQFNAIDVDKNGTISLEELKQIM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |