Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0409900_circ_g.3 |
ID in PlantcircBase | osa_circ_033484 |
Alias | Os07circ06380/Os_ciR898 |
Organism | Oryza sativa |
Position | chr7: 12797686-12801684 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os07g0409900 |
Parent gene annotation |
Plasma membrane-associated calcium-dependent protein kinase, Dir ect phosphorylation and activation of MAPK, Negative reguration of rice immunity (Os07t0409900-01);Similar to Calcium-dependent protein kinase. (Os07t0409900-02) |
Parent gene strand | - |
Alternative splicing | Os07g0409900_circ_g.1 Os07g0409900_circ_g.2 Os07g0409900_circ_g.4 Os07g0409900_circ_g.5 Os07g0409900_circ_g.6 Os07g0409900_circ_g.7 |
Support reads | 6/21/5 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0409900-01:7 Os07t0409900-02:7 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016974 |
PMCS | 0.447309531 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12801201-12801678(-) |
Potential amino acid sequence |
MLKVAAECHLHGLVHRDMKPENFLFKSTKEDSSLKATDFGLSDFIRPGKHFRDIVGSAYYVAPE VLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPWPNITPCAKDFV QKLLVKDPRARLTAAQALSHEWVREGGQASDIPLDISVLHNMRQFVKYSRFKQFALRALASTLN AEELSDLRDQFNAIDVDKNGTISLEELKQIM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |