Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0409900_circ_g.6 |
| ID in PlantcircBase | osa_circ_033487 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12801137-12802245 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0409900 |
| Parent gene annotation |
Plasma membrane-associated calcium-dependent protein kinase, Dir ect phosphorylation and activation of MAPK, Negative reguration of rice immunity (Os07t0409900-01);Similar to Calcium-dependent protein kinase. (Os07t0409900-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0409900_circ_g.1 Os07g0409900_circ_g.2 Os07g0409900_circ_g.3 Os07g0409900_circ_g.4 Os07g0409900_circ_g.5 Os07g0409900_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0409900-01:3 Os07t0409900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137225699 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12802247-12801139(-) |
| Potential amino acid sequence |
MVLPVAVEDVKREVKILKALQGHENVVHFYNAFEDDNYVYIVMELCEGGELLDRILAKKDSRYS EKDAAVVVRQMLKVAAECHLHGLVHRDMKPEMVLPVAVEDVKREVKILKALQGHENVVHFYNAF EDDNYVYIVMELCEGGELLDRILAKKDSRYSEKDAAVVVRQMLKVAAECHLHGLVHRDMKPEMV LPVAVEDVKREVKILKALQGHENVVHFYNAFEDDNYVYIVMELCEGGELLDRILAKKDSRYSEK DAAVVVRQMLKVAAECHLHGLVHRDMKPEMVLPVAVEDVKREVKILKALQGHENVVHFYNAFED DNYVYIVMELCEGGELLDRILAKKDSRYSEKDAAVVVRQMLKVAAECHLHGLVHRDMKPE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |